PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039966
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 409aa    MW: 46395.8 Da    PI: 5.9065
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039966genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16157203148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT  Ed +lv++v+++G + W+ Ia+++  gR +kqc++rw+++l
      Lus10039966 157 KGQWTVNEDRILVQLVERYGIRKWSHIAQMLS-GRIGKQCRERWHNHL 203
                      799*****************************.*************97 PP

2Myb_DNA-binding47.44.4e-15208250145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+eEd+ l++ +++  ++ W+ Ia+ ++ gRt++++k++w+
      Lus10039966 208 KDTWTEEEDKVLIQSHAEIKNK-WAEIAKSLP-GRTENSIKNHWN 250
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-23151209IPR009057Homeodomain-like
PROSITE profilePS5129427.293152207IPR017930Myb domain
SuperFamilySSF466891.62E-30154249IPR009057Homeodomain-like
SMARTSM007173.9E-14156205IPR001005SANT/Myb domain
CDDcd001675.11E-13160203No hitNo description
PfamPF139211.2E-14160209No hitNo description
SMARTSM007171.4E-13207255IPR001005SANT/Myb domain
PROSITE profilePS5129417.539208257IPR017930Myb domain
CDDcd001673.21E-11210253No hitNo description
Gene3DG3DSA:1.10.10.609.6E-18210251IPR009057Homeodomain-like
PfamPF139212.6E-8211255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MWSLNQVYGG GGGGSNFDSF DGNLYGSPYY SSLNLDCFEY ECKPFSDINI GYMNFQNNNN  60
NYFERNLMLG SSSSNNNQML NQEEAEIKPT AVAGAVMMNL DELNLYNNNN NNHQCDQYYL  120
ESSNNNTHLS TRRSGLMAPA TATRKIWKGR KKNNVVKGQW TVNEDRILVQ LVERYGIRKW  180
SHIAQMLSGR IGKQCRERWH NHLKPDIKDT WTEEEDKVLI QSHAEIKNKW AEIAKSLPGR  240
TENSIKNHWN ATKRRLYSKG KCRSKYPCGS ILQDYIKSLN LDTSAAANNL IASKRSSSSS  300
TIPNKANSSL LLDDQYPQHN LSENDRLVPT FYYNNEEVPD FGFDGCNLDS LLDGLPPIVD  360
GKGFDDLDVS IDDQQALIVA PSLRDDFEVE KELDLVEMMS VIKKLGFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-431552552103C-Myb DNA-Binding Domain
1msf_C7e-431552552103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511387.21e-116PREDICTED: transcription factor MYB98
TrEMBLB9RB121e-109B9RB12_RICCO; Myb119, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-79myb domain protein 98